DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG30088

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:277 Identity:93/277 - (33%)
Similarity:136/277 - (49%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TCGQS-----RRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVE 135
            :||.|     ..:..:||...|...|:||.|.|.::.:        |||::|::.|:||||||:.
  Fly    32 SCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEIH--------CGGTIISSRYILTAAHCMR 88

  Fly   136 YPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIAL 200
                  || || ||||||:.:.|||   ..| ...:|...|.::.....:::|:  |.|.|||||
  Fly    89 ------PY-LK-VRLGEHDITRNPD---CQG-GSCSPPAEEFDIVLATKYKRFD--RFLANDIAL 139

  Fly   201 VRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIA---ERHPDVCK 262
            ::|...:|:...||||||......|.:..:|||.||.......::.||..:.:.   .||   |:
  Fly   140 LKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRH---CR 201

  Fly   263 SNYDFNLG-SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAF 326
            |.....:. :|:|. |..|:||..|||||||:..|....|......||:|:|...|.    .|..
  Fly   202 SVLSMPITINQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ----SPGV 261

  Fly   327 YTKTSYFFEWIKSKLQS 343
            ||....:..||:..:||
  Fly   262 YTYVPNYIRWIRYVMQS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 85/250 (34%)
Tryp_SPc 93..337 CDD:214473 83/247 (34%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 86/257 (33%)
Tryp_SPc 45..273 CDD:238113 87/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.