DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG30082

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:285 Identity:92/285 - (32%)
Similarity:128/285 - (44%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VC-CPKWETYLPHDTCGQSRRKP-----TKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSL 121
            || .||.........||.:...|     ..|:...:...||:|   |.:||:   .||  |.|:|
  Fly    13 VCLTPKLRAQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLA---YLHKNS---SLV--CTGTL 69

  Fly   122 INNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYA-PLYMEIEVDQIITH 185
            |...:|||||||:      :.:.|.||||||::|||.     ::...::. |.|.|..|:....|
  Fly    70 ITKRFVLTAAHCL------HSFHLLTVRLGEYDTSTR-----IDCTSEFCIPTYEEYSVENAYIH 123

  Fly   186 EQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLR 250
            ..|...:...|||.|::|...|.|...|:||||.|......:...::|:||..:.....:.||..
  Fly   124 TFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTATVLQT 188

  Fly   251 SFIAERHPDVCKSNYDFNLG-SQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQ 314
            ..:.......|:.:...:|. .|.|||.... ||..|||||||...:..|::|.|...||:|||.
  Fly   189 VNLIRLDQSDCERSLRTSLSYGQFCAGQWRA-DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGH 252

  Fly   315 KPCVLKTCKPAFYTKTSYFFEWIKS 339
            ..|    ..|..||....|..||.|
  Fly   253 YLC----RGPGVYTYVPSFTNWILS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 84/249 (34%)
Tryp_SPc 93..337 CDD:214473 81/245 (33%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 82/255 (32%)
Tryp_SPc 40..274 CDD:238113 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.