DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Klk1b3

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_113711.1 Gene:Klk1b3 / 24594 RGDID:3175 Length:265 Species:Rattus norvegicus


Alignment Length:274 Identity:78/274 - (28%)
Similarity:106/274 - (38%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTS 156
            :|..||...:.|     ..:.|   |||.||:..:|:|||||....:.        |.||.:|..
  Rat    37 MNSQPWQVAVYY-----FGEYL---CGGVLIDPSWVITAAHCATDNYQ--------VWLGRNNLY 85

  Fly   157 TNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNR----------GRRLINDIALVRLKFPVRYTR 211
            .:            .|......|.|...|..||:          |....||:.|:.|..|...|.
  Rat    86 ED------------EPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITD 138

  Fly   212 AIQPICLP-RAQKLAAHKRKFQASGW----PDMG-------QGIASEVLLRSFIAERHPDVCKSN 264
            .::.|.|| ...|:.:   ...||||    || |       |.:..::|......|.|.:.... 
  Rat   139 GVKVIDLPIEEPKVGS---TCLASGWGSITPD-GLELSDDLQCVNIDLLSNEKCVEAHKEEVTD- 198

  Fly   265 YDFNLGSQICAGGLD-GNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYT 328
                  ..:|||.:| |.||..|||||||   :..|.:     .||.|:|..||. :..||..||
  Rat   199 ------LMLCAGEMDGGKDTCKGDSGGPL---ICNGVL-----QGITSWGFNPCG-EPKKPGIYT 248

  Fly   329 KTSYFFEWIKSKLQ 342
            |...|..|||..::
  Rat   249 KLIKFTPWIKEVMK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 78/269 (29%)
Tryp_SPc 93..337 CDD:214473 75/266 (28%)
Klk1b3NP_113711.1 Tryp_SPc 28..257 CDD:214473 75/267 (28%)
Tryp_SPc 29..260 CDD:238113 78/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.