DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and F10

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:322 Identity:86/322 - (26%)
Similarity:137/322 - (42%) Gaps:75/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WETY---------LPHDTCGQSRRKPTKG--KIPAL--------NEFPWMAMLLYGNKNNLSQKL 113
            |:.|         .|.|....::.:|.:|  .:..:        .|.||.|:|:  |:.|..   
Human   200 WKPYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLI--NEENEG--- 259

  Fly   114 VPKCGGSLINNWYVLTAAHCVEYPFMDYPYALK--TVRLGEHNTSTNPDRAIVNGRRQYAPLYME 176
              .|||::::.:|:||||||:        |..|  .||:|:.||........|:           
Human   260 --FCGGTILSEFYILTAAHCL--------YQAKRFKVRVGDRNTEQEEGGEAVH----------- 303

  Fly   177 IEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPR---AQKLAAHKRKFQASGW-- 236
             ||:.:|.|.:|.: .....|||::|||.|:.:...:.|.|||.   |:.....::....||:  
Human   304 -EVEVVIKHNRFTK-ETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGR 366

  Fly   237 -PDMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLD--GNDTSPGDSGGPLMETVIR 298
             .:.|:......:|.....:|:.  ||.:..|.:...:...|.|  ..|...||||||   .|.|
Human   367 THEKGRQSTRLKMLEVPYVDRNS--CKLSSSFIITQNMFCAGYDTKQEDACQGDSGGP---HVTR 426

  Fly   299 GKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWI----------KSKLQSPFIDSDS 350
            .|.|. :..||:|:|: .|..|. |...|||.:.|.:||          |:|..:|.:.:.|
Human   427 FKDTY-FVTGIVSWGE-GCARKG-KYGIYTKVTAFLKWIDRSMKTRGLPKAKSHAPEVITSS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 77/266 (29%)
Tryp_SPc 93..337 CDD:214473 74/253 (29%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203 1/2 (50%)
Tryp_SPc 235..464 CDD:238113 76/264 (29%)
O-glycosylated at one site 476..485 1/8 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.