DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and T22A3.6

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:112 Identity:22/112 - (19%)
Similarity:39/112 - (34%) Gaps:38/112 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DMGQGIASEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVT 302
            |:....:|...:...:.:.:.:.|: |.|.|.....|   ..||||:                  
 Worm   123 DISDSSSSSYSMNRILPDEYENFCR-NPDKNPLGPWC---YVGNDTT------------------ 165

  Fly   303 LTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQSPFIDSD 349
                        .|| .:.|:|:  |:||..|..: ::...|:.|.|
 Worm   166 ------------APC-FQPCRPS--TETSSDFVCL-NRDGFPYTDYD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 19/101 (19%)
Tryp_SPc 93..337 CDD:214473 19/98 (19%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.