DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and try-10

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:247 Identity:56/247 - (22%)
Similarity:96/247 - (38%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 CGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQ 181
            |||.||....|:|:|||| :...|:....| |.||:.:.:.:.|     |.:::....|      
 Worm   104 CGGVLIAPSIVITSAHCV-FSGDDFAVTAK-VTLGDVHLNKHDD-----GEQEFRSHAM------ 155

  Fly   182 IITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQ-------------- 232
            .|:.:.||......:|:|::.|  |.|......|:.|..|:..:.....|:              
 Worm   156 AISKKFFNDASEANDDVAVIFL--PQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSV 218

  Fly   233 --ASGWPDMGQGIA--SEVLLRSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTS-PGDSGGPL 292
              .:||.......|  |:.:.:..:......:.|..|       :.|..:.|:..: .||||.|:
 Worm   219 CYVAGWGKTENKTAKYSDSVRQMMVNLSVRRIGKRKY-------LIAKAVTGSSRACMGDSGSPV 276

  Fly   293 METVIRGKVTLTYAAGIISYG----QKPC-VLKTCKPAFYTKTSYFFEWIKS 339
            ...|...::.:...|.|.|:.    |.|. .:..|:...||..|   :|.:|
 Worm   277 YCFVNGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVS---DWRES 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 56/247 (23%)
Tryp_SPc 93..337 CDD:214473 54/243 (22%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 45/207 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.