DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and Klk1b5

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_032482.1 Gene:Klk1b5 / 16622 MGIID:892020 Length:261 Species:Mus musculus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:113/275 - (41%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NEFPWMAMLLYGNKNNLSQKLVPKCGGSLIN-NWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTS 156
            |..||...:....|.        :|||.|:| || |||||||....:.        |.||::|  
Mouse    34 NSQPWQVAVYRFTKY--------QCGGVLLNANW-VLTAAHCHNDKYQ--------VWLGKNN-- 79

  Fly   157 TNPDRAIVNGRRQYAPLYMEIE-------VDQIITHEQFNRGRRLI------------NDIALVR 202
                             :.|.|       |.:.|.|..||..  |:            ||:.|:|
Mouse    80 -----------------FFEDEPSAQHRLVSKAIPHPDFNMS--LLNEHTPQPEDDYSNDLMLLR 125

  Fly   203 LKFPVRYTRAIQPICLPRAQ-KLAAHKRKFQASGWPDMGQGI---ASEVLLRSFIAERHPDVCKS 263
            ||.|...|..::||.||..: ||.:   ...||||..:...|   |.::...:|....:.|..|:
Mouse   126 LKKPADITDVVKPIDLPTEEPKLGS---TCLASGWGSITPVIYEPADDLQCVNFKLLPNEDCVKA 187

  Fly   264 NYDFNLGSQICAGGLD-GNDTSPGDSGGPLM-ETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAF 326
            :.:......:|||.:| |.||..|||||||: :.|:.         ||.|:|..||. |...|..
Mouse   188 HIEKVTDVMLCAGDMDGGKDTCMGDSGGPLICDGVLH---------GITSWGPSPCG-KPNVPGI 242

  Fly   327 YTKTSYFFEWIKSKL 341
            |||...|..|||..:
Mouse   243 YTKLIKFNSWIKDTI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 83/272 (31%)
Tryp_SPc 93..337 CDD:214473 80/269 (30%)
Klk1b5NP_032482.1 Tryp_SPc 24..253 CDD:214473 80/269 (30%)
Tryp_SPc 25..256 CDD:238113 83/272 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.