DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG43742

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:261 Identity:91/261 - (34%)
Similarity:119/261 - (45%) Gaps:51/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNG 166
            ||.|....       ||||||:..|||||||||.    |....  ||.|||:|.|. |.....:.
  Fly    50 LYNNSEFF-------CGGSLIHKQYVLTAAHCVR----DLDEV--TVHLGENNRSC-PIPVCKHV 100

  Fly   167 RRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAA-HKRK 230
            .|..|         ::|.|..|: |...:|||||:||:..|.:...|:|||:...:.:.: ::..
  Fly   101 LRLNA---------KVILHPNFH-GNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNN 155

  Fly   231 FQASGWPDMGQGIASEVLLRSFI-AERHP-DVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLM 293
            |.|.||.....|..|:||  ||| ..|.| .:|..|.     :.||||...| ||...||||||:
  Fly   156 FTAYGWGKTEHGNISDVL--SFIDLVRLPKSMCYQNI-----NTICAGSTSG-DTCESDSGGPLI 212

  Fly   294 ETVI-RGKVTLTYAAGIISYGQKPCVLKTCKPAF--YTKTSYFFEWIKS-------KLQSPFIDS 348
            ...: ||| :.....||.|||.     ..|...|  ||..:.:..||.|       :|.:.:..|
  Fly   213 GNFVHRGK-SRDILFGITSYGD-----AECSGLFGVYTDVNAYKSWIASVVLESEPRLLNEYCKS 271

  Fly   349 D 349
            |
  Fly   272 D 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 88/250 (35%)
Tryp_SPc 93..337 CDD:214473 85/240 (35%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 85/240 (35%)
Tryp_SPc 35..256 CDD:238113 87/243 (36%)
Tryp_SPc 273..467 CDD:214473 91/261 (35%)
Tryp_SPc 273..>368 CDD:304450 91/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.