DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG43336

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:123/277 - (44%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CGQSRRKPT-----KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY 136
            ||.....|:     .|.:.:|...||||.|     ::...:.:  ||||||.|..|||||||   
  Fly    26 CGIRAHSPSVPRVKNGTVASLTSSPWMAFL-----HSTDGRFI--CGGSLITNRLVLTAAHC--- 80

  Fly   137 PFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLY-------MEIEVDQIITHEQFNRGRRL 194
             |:|....:  .||||::            |.:|...:       :|..|::...|..:| ...:
  Fly    81 -FLDRTELV--ARLGEYD------------REEYEMCHDSYCTYRIEAMVERGFRHRHYN-PMTM 129

  Fly   195 INDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAER 256
            ..|||::||...|:||..|:|||:   ||.:|..........:||........|..|....:|.:
  Fly   130 AYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARK 194

  Fly   257 HPDVCKSNYDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLK 320
            ||:||:.....:| .:|.|||. :.::...||||||:...:..||.......||.|:....||: 
  Fly   195 HPEVCRRYATLSLTANQFCAGN-ERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVM- 257

  Fly   321 TCKPAFYTKTSYFFEWI 337
               .:.:|....:.:||
  Fly   258 ---VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 76/256 (30%)
Tryp_SPc 93..337 CDD:214473 74/254 (29%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 76/264 (29%)
Tryp_SPc 40..271 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.