DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG43335

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:297 Identity:92/297 - (30%)
Similarity:125/297 - (42%) Gaps:58/297 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VC---CPKWETYLPHDTCGQSRRKPT-------KGKIPALNEFPWMAMLLYGNKNNLSQKLVPKC 117
            ||   |...|:.|....|| .|..|:       .|....:...|||| .||...:..       |
  Fly    12 VCQWLCRFGESRLLEPNCG-IRTMPSFHRTRIIGGSDAEITSHPWMA-YLYNEFHYF-------C 67

  Fly   118 GGSLINNWYVLTAAHCVEYPFMDYPYALK--TVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVD 180
            .|:||.|.:|||||||:|        |.|  |||||.... |..|.::.....:      :..|.
  Fly    68 AGTLITNQFVLTAAHCIE--------ASKNLTVRLGGSGL-TRSDGSMCQITAE------DYSVS 117

  Fly   181 QIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQG 242
            ..|.|:.|... .::||||::||...|::...|:|||:   |..:.|........|:||....:.
  Fly   118 MAIKHKYFTPS-IMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWGLADKR 181

  Fly   243 IASEVLLRSFIAERHPDVCKSNYDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYA 306
            :...:|..:.|...:.:||...||..: ..|||||..:.| |..|||||||      |.|...|.
  Fly   182 MHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDKETN-TCLGDSGGPL------GGVVNYYG 239

  Fly   307 ------AGIISYGQKPCVLKTCKPAFYTKTSYFFEWI 337
                  .||.|:|...|    ..|:.||..|.:..||
  Fly   240 DLRFVQYGITSFGDIEC----RSPSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 82/257 (32%)
Tryp_SPc 93..337 CDD:214473 80/255 (31%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 81/265 (31%)
Tryp_SPc 42..275 CDD:238113 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.