DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and MASP2

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:378 Identity:100/378 - (26%)
Similarity:142/378 - (37%) Gaps:104/378 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AGCQFD------------TECVNLDKCPRTR-------------AVMNSSRKNIIGLRRCGTNKV 63
            |.||.|            .:|...|..|..|             ||:..|.:......:....|.
Human   346 AVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKY 410

  Fly    64 CC--------PKWETYLP--HDTCGQSRRKPTKGKI-------PALNEFPWMAMLLYGNKNNLSQ 111
            .|        .|.|..||  ...||.|.| .|.|:|       |  .:|||..::|.|       
Human   411 VCEADGFWTSSKGEKSLPVCEPVCGLSAR-TTGGRIYGGQKAKP--GDFPWQVLILGG------- 465

  Fly   112 KLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYME 176
              ....|..|.:|| ||||||.|        |..|      |:.|....|  :...::.:|.|.:
Human   466 --TTAAGALLYDNW-VLTAAHAV--------YEQK------HDASALDIR--MGTLKRLSPHYTQ 511

  Fly   177 IEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPR--AQKLAAHKRKFQASGWPDM 239
            ...:.:..||.:.......|||||::|...|.....|.||||||  |:..........||||   
Human   512 AWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGW--- 573

  Fly   240 GQGIASEVLLRSFIAER--HPDV-------CKSNYD---FNLGS----QICAGGLD--GNDTSPG 286
              |:..    |.|:|..  :.|:       |.:.|:   :..||    .:|| ||:  |.|:..|
Human   574 --GLTQ----RGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCA-GLESGGKDSCRG 631

  Fly   287 DSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIKS 339
            ||||.|:  .:..:....:..||:|:|...|. :..:...|||...:..||::
Human   632 DSGGALV--FLDSETERWFVGGIVSWGSMNCG-EAGQYGVYTKVINYIPWIEN 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 75/267 (28%)
Tryp_SPc 93..337 CDD:214473 73/263 (28%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478 4/14 (29%)
Sushi 366..430 CDD:278512 13/63 (21%)
Tryp_SPc 444..679 CDD:214473 75/275 (27%)
Tryp_SPc 445..682 CDD:238113 77/278 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.