DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and CG42694

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:287 Identity:73/287 - (25%)
Similarity:120/287 - (41%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DTCGQ--SRRKPTKGKIPALNEFPWMAMLLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYP 137
            |.||.  |.:..||.:.|   :..|:|        ::|......|.||||:..:||:||.|::. 
  Fly    25 DYCGAPISNQSITKLRQP---QAGWLA--------HISNGTHVLCSGSLISKQFVLSAAQCIDV- 77

  Fly   138 FMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVR 202
                 :....|:||..|.:.:|.             :..:....|.:|.    |:||..||.|::
  Fly    78 -----HGKLFVQLGVSNATKSPH-------------WYTVSNVVIPSHS----GKRLQRDIGLLK 120

  Fly   203 LKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDVCKSN 264
            |...|.|...:.|||:   .....:....:.|..|.|....:...:.||     ::...|.||.|
  Fly   121 LSQSVDYNDFVYPICIALNTNTLDMVKILQNFTTSAWLSKNKNPQTIVL-----SQLSRDRCKLN 180

  Fly   265 YDFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRG-KVTLTYAAGIISY--GQKPCVLKTCKPA 325
            ...|: ..:|||..|..|::...|||..|.:.:|:| .:......||..|  |:..|    .:||
  Fly   181 LSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWC----SEPA 241

  Fly   326 FYTKTSYFFEWIKSKLQSPFIDSDSKS 352
            .|...:....||::.:|. :..:||::
  Fly   242 IYIDVAECVGWIETVVQQ-YDGTDSRA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 63/253 (25%)
Tryp_SPc 93..337 CDD:214473 61/250 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 63/249 (25%)
Tryp_SPc 46..253 CDD:214473 61/246 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463689
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.