DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8870 and LOC100004411

DIOPT Version :9

Sequence 1:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:283 Identity:77/283 - (27%)
Similarity:121/283 - (42%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TCGQSRRKPTKGKIPALNEFPWMAMLL----YGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEY 136
            |.|....:...|::......||..:|.    ||           .|||||||..:|:|||||:: 
Zfish   241 TGGNEDTRIVGGQLQRQGGSPWQVLLRREDEYG-----------FCGGSLINQRWVITAAHCLQ- 293

  Fly   137 PFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALV 201
               ..|:   .:.:|::: ...||:.           ..:|.|::||.|..::. ....:||||:
Zfish   294 ---QTPH---HITIGDYD-KMRPDKD-----------EQKITVEKIIPHPHYHE-YTFDSDIALL 339

  Fly   202 RLKFPVRYTRAIQPICLP---RAQKLAAHKRKFQASGWPDMGQGIASEVLLRS--FIAERHPDVC 261
            .|...|.......|.|||   .|::|.....:...|||.      ::..|.||  |:.:....|.
Zfish   340 YLSSAVTLGPFASPACLPDANLAERLMKPGEQGLVSGWG------STHYLQRSSRFLRKVQLPVV 398

  Fly   262 KSNYDFNLGSQI------CAGGL-DGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVL 319
            :.....|...||      |||.| :..|...||||||.:.. .||...||   |::|:|:: |..
Zfish   399 EQKSCINSTEQIITDNMFCAGFLMEEMDACTGDSGGPFIVN-YRGTWFLT---GVVSWGER-CAS 458

  Fly   320 KTCKPAFYTKTSYFFEWIKSKLQ 342
            :. |...||:...:..||:.:::
Zfish   459 QG-KYGVYTRLGNYLSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 74/262 (28%)
Tryp_SPc 93..337 CDD:214473 72/259 (28%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 73/269 (27%)
Tryp_SPc 249..477 CDD:238113 75/270 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.