DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lip3 and AT1G15060

DIOPT Version :9

Sequence 1:NP_477331.1 Gene:Lip3 / 41643 FlyBaseID:FBgn0023495 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_001319006.1 Gene:AT1G15060 / 838071 AraportID:AT1G15060 Length:578 Species:Arabidopsis thaliana


Alignment Length:283 Identity:62/283 - (21%)
Similarity:93/283 - (32%) Gaps:95/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DVPAMIDYVLA--KTGQQQVQYVGHSQGTTVYLVMVSERPEYNDKIKSAHLLGPAAYMGNMKSPL 203
            ||||.|:||.|  |....::..:|||.|..:...|:|.                .|:.|.     
plant   338 DVPAAIEYVRAQSKPKDGKLFAIGHSMGGILLYAMLSR----------------CAFEGR----- 381

  Fly   204 TRAFAPILGQPN--AIVEVCGSMEFMPSNKFKQ-----------------DLGIEMCQA-----T 244
                     :|:  |:..:..|:::..||...:                 .||..:..|     .
plant   382 ---------EPSVAAVATLASSVDYTTSNSALKLLIPLANPAEALSVPVVPLGALLAAAFPLSTR 437

  Fly   245 SPYADMCANEIFLIGGYDTEQLDYELLEHIK----ATSPAGASVNQNLHFCQ---EYNSGKFRKF 302
            .||.....|::.    ..|:.:..|:||.:.    .|.||...:.....|.:   ...||||...
plant   438 PPYVLSWLNDLI----SSTDMMHPEMLEKLVLNNFCTIPAKLLIQLTTAFREGGLRDRSGKFYYK 498

  Fly   303 DYTALRNPYEYGSYFPPDYKLKNAKAPVLLYYGANDWMCD---VSDVRKLRDELPNMALDYLVPF 364
            |:                  |.....|||...|..|.:|.   |.|..||   .|...:.|.:..
plant   499 DH------------------LPRTSVPVLALAGDRDLICPPAAVEDTVKL---FPENLVTYKLLG 542

  Fly   365 E----KWAHLDFIWGTEARKYVY 383
            |    .:||.|.:.|..|.:.||
plant   543 EPDGPHYAHYDLVGGRLAVEQVY 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lip3NP_477331.1 PLN02872 26..392 CDD:215470 62/283 (22%)
Abhydro_lipase 30..89 CDD:282003
Abhydrolase_5 74..>192 CDD:289465 15/52 (29%)
Abhydrolase_5 <315..355 CDD:289465 11/42 (26%)
AT1G15060NP_001319006.1 Hydrolase_4 <330..545 CDD:403389 55/261 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11005
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.