DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA87a and CheA75a

DIOPT Version :9

Sequence 1:NP_650280.1 Gene:CheA87a / 41642 FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:191 Identity:38/191 - (19%)
Similarity:82/191 - (42%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAIIVLTSNITVQAKRTFRIQKLEKVTEDTSY--LRSRLRIAESEE------NELKVSG------ 64
            |.||||             :|.|||:..:.||  ...||...|.:.      :.||..|      
  Fly     4 LVIIVL-------------LQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERALN 55

  Fly    65 --YLDLNQRLDNDWTVVLKVSRSPDSDGDYEKVL--TFEMQLCDFMKSYYKDIFYERIK--EYSN 123
              :..|.:..::|:.|.:::..||:.||::::::  ..:..:|:..|.:|.......:|  |.:|
  Fly    56 GSFKFLGEMNNDDFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETTN 120

  Fly   124 AP--HPSSCPLPKERYVLEDYPFNVKLLKKLMSPGFYRIKYTLKNEETKILSYVLDLELEE 182
            .|  ....||:|:..:.:::...|.:.....:..|..:...|..:....:...::::::|:
  Fly   121 FPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKIED 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA87aNP_650280.1 DM8 91..181 CDD:214778 13/95 (14%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 13/94 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.