DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA87a and CG18537

DIOPT Version :9

Sequence 1:NP_650280.1 Gene:CheA87a / 41642 FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster


Alignment Length:176 Identity:38/176 - (21%)
Similarity:68/176 - (38%) Gaps:12/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLRIAESEENELKVSGYLDLNQRLD 73
            |.:.:|..:.|.|......|..:....:...:.|.|.::....|......:..:|..::.|....
  Fly     6 SSVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTT 70

  Fly    74 NDWTVVLKVSRSPDSDGDYEKVLTF---EMQLCDFMKSYYKDIFYERIKEYSNAP------HPSS 129
            .:..|...|.||...|....|:|.:   :....|::.|||||:..:.....||.|      .|  
  Fly    71 EETMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQP-- 133

  Fly   130 CPLPKERYVLEDYPFNVKLLKKLMSPGFYRIKYTLKNEETKILSYV 175
             |.||..|:.:...|..:....::.||||:|.:.....:....|::
  Fly   134 -PWPKRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA87aNP_650280.1 DM8 91..181 CDD:214778 23/94 (24%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.