DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment poly and ELP6

DIOPT Version :9

Sequence 1:NP_001189215.1 Gene:poly / 41641 FlyBaseID:FBgn0086371 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_014043.1 Gene:ELP6 / 855360 SGDID:S000004929 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:61/283 - (21%)
Similarity:112/283 - (39%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NEQKLPGFVHISEESNVDASFLI---SC--------------VLGQRLRISNAGTLLV---CLQH 56
            ::..||  .|..::||....|.|   ||              |||....::.:.:.::   ...|
Yeast    14 DQSVLP--AHFFQDSNSHNLFFITHQSCTQPLWMINALVETHVLGSPSSLNESSSSMLPSSTRSH 76

  Fly    57 -------HYQHYF-NAGMRLGYNTNIFQGKTLGVIDVLSDMAGEGLASKWLTNTEGQTLTDQLVE 113
                   |.|:|| |:..:|...:|.:     .|:|.|||         ::.|.......|:::.
Yeast    77 AVLASFIHEQNYFTNSLNKLKIPSNNY-----NVLDFLSD---------FIVNNIHNKPRDKILS 127

  Fly   114 DIRAQVERNYASRNSYT---VLIDN----LSILFNLGASKLQVQQFCQDLAALGKEREKLTVITK 171
            |:.|:.  :.|.:|:.|   |:|:.    ||::..|..|:|. .:|...|.      .:..|:..
Yeast   128 DVLAKF--SAAIQNNPTDTIVIIEQPELLLSLVSGLTCSELN-NKFITPLL------RQCKVLII 183

  Fly   172 LSNSDIYQLTD-------NNVAKL-------GQVRIQVLRLKSGVFREVDGKLLIER---VLDEG 219
            :|||||:.:.:       :|:...       ..:.:.:..||:|..::|.|.|.:.|   .:...
Yeast   184 VSNSDIFNIDEYDASVHSSNLQNFYKSSFIKSMINLNLNPLKTGFAKDVTGSLHVCRGGAPIATS 248

  Fly   220 NYACEETRKEVLYKVNDRNVKVF 242
            |.:......|.||.....:.|:|
Yeast   249 NTSLHVVENEYLYLNEKESTKLF 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyNP_001189215.1 ELP6 26..236 CDD:286845 56/261 (21%)
ELP6NP_014043.1 Elp456 32..221 CDD:410887 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16184
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.