DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment poly and ELP6

DIOPT Version :9

Sequence 1:NP_001189215.1 Gene:poly / 41641 FlyBaseID:FBgn0086371 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_567351.1 Gene:ELP6 / 826600 AraportID:AT4G10090 Length:262 Species:Arabidopsis thaliana


Alignment Length:268 Identity:60/268 - (22%)
Similarity:107/268 - (39%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LACGLNEQ-----KLPGFVHISEES-NVDASFLISCVLGQRLRISNAGTLLVCL--QHHYQHYFN 63
            ||.|.:||     .|.|.|.:.|:. ....||::..:: :|:..||:...|:.|  ...:.||..
plant    10 LALGFDEQLAIPSPLNGKVILIEDCVETSGSFVLHQLM-KRVLSSNSSDALIFLAFARPFSHYDR 73

  Fly    64 AGMRLGYNTNIFQGKT-LGVIDVLSDMAGEGLASKWLTNTEGQTLTDQLVEDIRA---------Q 118
            ...:||.|....:... |...|:|.....:|               ||:.:::.|         :
plant    74 ILRKLGCNLATHKSNNRLVFFDMLMVKCSDG---------------DQMEDNVSAVAKLFREIQE 123

  Fly   119 VERNYASRNS--YTVLIDNLSIL--FNLGASKLQVQQFCQDLAALGKEREKLTVITKLSNSDIYQ 179
            ..|...|..|  .||::|::|:|  ...|::...|..|......|..|.....||  |::.|||.
plant   124 TVRKLQSVTSGNITVMVDDMSLLEIATTGSNSDHVLDFLHYCHTLSSESNCSLVI--LNHEDIYA 186

  Fly   180 LTDN-----NVAKLGQVRIQVLRLKSGVFREVDGKLLI--ERVLDEGNYACEETRKEVLYKVNDR 237
            ..:.     .:..|..|.|:...|.||:..:|.|:|.:  :.:.:.|..:.....:...:::.:.
plant   187 SMERPAFLLQMVCLADVVIKAEPLASGLANDVHGQLTVLNKGISNSGRGSSRNKLQNFQFRIKEN 251

  Fly   238 NVKVFAPG 245
            .:..|.||
plant   252 GIDYFYPG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyNP_001189215.1 ELP6 26..236 CDD:286845 48/233 (21%)
ELP6NP_567351.1 Elp6 27..258 CDD:410903 51/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272502at2759
OrthoFinder 1 1.000 - - FOG0006331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16184
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.