DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment poly and Elp6

DIOPT Version :9

Sequence 1:NP_001189215.1 Gene:poly / 41641 FlyBaseID:FBgn0086371 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001102252.1 Gene:Elp6 / 363150 RGDID:1305478 Length:266 Species:Rattus norvegicus


Alignment Length:236 Identity:53/236 - (22%)
Similarity:92/236 - (38%) Gaps:16/236 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ESNVDASFLISCVLGQRLRISNAGTLLVCLQHHYQHYFNAGMRLGYNTN--------IFQGKTLG 81
            ::..|.|||:...|...|: :|.....|.|...:.||...|.:||.:..        :|......
  Rat    26 DAKTDGSFLVHHFLSFYLK-ANCKVCFVALVQSFSHYNIVGQKLGVSLTAARERGQLVFLEGLKS 89

  Fly    82 VIDVLSDMAGEGLASKWLTNTEGQTLTD--QLVEDIRAQVERNYASRNSYTVLIDNLSILFNLGA 144
            .::||.....|....::|.......|..  ..::|.....:...:......:|:||||:|.:||.
  Rat    90 SVEVLFHSQEEPHPLQFLREAGAGNLQSLYTFIQDTLKPADSGESPWKCPVLLVDNLSVLLSLGV 154

  Fly   145 SKLQVQQFCQDLAALGKEREKLTVITKLSNSDIYQLTDNNVAKLG-----QVRIQVLRLKSGVFR 204
            ..:.|..|.|...|......|..|:..:.:::..:..:||:...|     .:.::...|.:|..:
  Rat   155 GAVAVLDFMQYCRATVCCELKGNVVALVHDTEGAEDEENNILLNGLSHQSHLILRTQGLATGFCK 219

  Fly   205 EVDGKLLIERVLDEGNYACEETRKEVLYKVNDRNVKVFAPG 245
            :|.|:|.|.........|.........||:.|:||..||.|
  Rat   220 DVHGQLSILWRRSSQPTAQRARSLTYQYKIQDKNVSFFAKG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyNP_001189215.1 ELP6 26..236 CDD:286845 47/224 (21%)
Elp6NP_001102252.1 ELP6 2..251 CDD:370711 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5391
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1272502at2759
OrthoFinder 1 1.000 - - FOG0006331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16184
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.