DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment poly and elp6

DIOPT Version :9

Sequence 1:NP_001189215.1 Gene:poly / 41641 FlyBaseID:FBgn0086371 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_595765.1 Gene:elp6 / 2540979 PomBaseID:SPBC3H7.10 Length:249 Species:Schizosaccharomyces pombe


Alignment Length:145 Identity:35/145 - (24%)
Similarity:71/145 - (48%) Gaps:14/145 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IRAQVERNYASRNSYTVLIDNLSILFN---LGASKLQVQQFCQDLAALGKEREKLTVITKLSNSD 176
            |:...|.::...|| |::|:::.||.:   |.::|:|     |.:..|.|...::.|...|....
pombe   111 IQCVEENDFEFENS-TIIIEDIDILQSTHALDSTKIQ-----QAILELRKCFSRVIVNVTLGAPL 169

  Fly   177 IYQLT-DNNVAKLGQVRIQVLRLKSGVFREVDGKLLIERVLDE-GNYAC---EETRKEVLYKVND 236
            ..|.: .:::..:....|....|.||..|.:.|.|.:.|:.:. .:..|   |:..||:||:|.:
pombe   170 PQQKSLGSSIGHMATRCISCRPLTSGSARRITGFLRLSRMPNHFRSGICETPEDDDKELLYEVTE 234

  Fly   237 RNVKVFAPGEIGVKV 251
            ...||::.|::.:::
pombe   235 AGAKVYSKGQVTLQL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
polyNP_001189215.1 ELP6 26..236 CDD:286845 32/128 (25%)
elp6NP_595765.1 ELP6 19..>80 CDD:286845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16184
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.