DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and SLC25A27

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:307 Identity:84/307 - (27%)
Similarity:148/307 - (48%) Gaps:49/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL-------IP---------KLAREQ 54
            |.|.:...|.|:..|.:.|.||||.|..|| .||..::|:|       .|         .:..|:
Human    19 RASKFLLSGCAATVAELATFPLDLTKTRLQ-MQGEAALARLGDGARESAPYRGMVRTALGIIEEE 82

  Fly    55 GVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTDS-----------FGGKVALAGASGLVGG 108
            |.|..:.|::.::.|.:.||..|...||..::.|...|           .||.:|     |::|.
Human    83 GFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMA-----GVIGQ 142

  Fly   109 IVGTPADMVNVRMQNDVKL----PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMT 169
            .:..|.|:|.|:||.:.|.    .|.:.|..::||   .::..:.|.:.|::|......|..|:.
Human   143 FLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAF---AKILAEGGIRGLWAGWVPNIQRAALVN 204

  Fly   170 IGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWD 234
            :|.:..||..|.||:.....:||::||..:||.:|.:|:.|..|.||:|:|.|| :|.:..|...
Human   205 MGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDKQGRGL 268

  Fly   235 IVKHTAKL--------GPLGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            :.|.:...        |.:..:||::|:::|:.|.:::.::..|::|
Human   269 LYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 27/97 (28%)
PTZ00169 13..273 CDD:240302 81/298 (27%)
Mito_carr 89..184 CDD:278578 27/109 (25%)
Mito_carr 189..278 CDD:278578 27/93 (29%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 28/98 (29%)
Solcar 1 21..115 27/94 (29%)
Mito_carr 125..219 CDD:365909 26/101 (26%)
Solcar 2 125..217 25/99 (25%)
Solcar 3 226..317 27/91 (30%)
Mito_carr 227..317 CDD:365909 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.