DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Slc25a27

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:292 Identity:82/292 - (28%)
Similarity:138/292 - (47%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL-------IP---------KLAREQ 54
            |.|.:...|.|:..|.:.|.||||.|..|| .||..::|:|       .|         .:.:|:
  Rat    18 RTSKFLLSGCAATVAELATFPLDLTKTRLQ-MQGEAALAKLGDGAMESAPYRGMMRTALGIVQEE 81

  Fly    55 GVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTDS-----------FGGKVALAGASGLVGG 108
            |.|..:.|::.::.|.:.||..|...||..::.|...|           .||.:|     |::|.
  Rat    82 GFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMA-----GVIGQ 141

  Fly   109 IVGTPADMVNVRMQNDVKL----PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMT 169
            .:..|.|:|.|:||.:.|.    .|.:.|..::||   .::..:.|.:.|::|......|..|:.
  Rat   142 FLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAF---AKILAEGGIRGLWAGWIPNIQRAALVN 203

  Fly   170 IGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWD 234
            :|.:..||..|.||:.....:||:.||..:||.:|.:|:.|..|.||:|:|.|| :|.:..|...
  Rat   204 MGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDKQGRGL 267

  Fly   235 IVKHTAKL--------GPLGFFKGYVPAFVRL 258
            :.|.:...        |.|..:||::|:::|:
  Rat   268 LYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 27/97 (28%)
PTZ00169 13..273 CDD:240302 80/285 (28%)
Mito_carr 89..184 CDD:278578 27/109 (25%)
Mito_carr 189..278 CDD:278578 25/78 (32%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 28/99 (28%)
Mito_carr 122..218 CDD:278578 26/103 (25%)
Mito_carr 224..311 CDD:278578 25/77 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.