DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and ucp1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:279 Identity:94/279 - (33%)
Similarity:140/279 - (50%) Gaps:23/279 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLASVGAAMVTHPLDLIKVTLQTQ---------QG--HLSVAQLIPKLAREQGVLVFYNGLSASV 67
            |.|:..|.:||.|||..||.||.|         :|  :..|...|..:.|.:|....||||.|.:
Zfish    21 GTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYNGLVAGL 85

  Fly    68 LRQLTYSTARFGVYEAGKKYVNTDSFGGKVA---LAG-ASGLVGGIVGTPADMVNVRMQNDVKLP 128
            .||:.:::.|.|:|:..|.:.........||   ||| .:|.:...:..|.|:|.||.|..:.|.
Zfish    86 QRQMAFASIRIGLYDNVKSFYTRGKDNPNVAVRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNLQ 150

  Fly   129 PQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNL 193
            ...|| ||.......::::.||.:.|:.|......|..|:...::..||..|..:|......|||
Zfish   151 GVGRR-YNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLLSDNL 214

  Fly   194 VTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF----NGLWDIVKHTAKLGPLGFFKGYVPA 254
            ..||.::..||.|.|.:..|:||:|||.||:.||::    |..|.::   .|.||..|:||:||:
Zfish   215 PCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQYSSSTNCAWTML---TKEGPTAFYKGFVPS 276

  Fly   255 FVRLGPHTIITFVFLEQLR 273
            |:|||...::.||..|||:
Zfish   277 FLRLGSWNVVMFVSFEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/88 (33%)
PTZ00169 13..273 CDD:240302 93/277 (34%)
Mito_carr 89..184 CDD:278578 26/98 (27%)
Mito_carr 189..278 CDD:278578 38/89 (43%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 29/88 (33%)
Mito_carr 111..208 CDD:395101 27/97 (28%)
Mito_carr 213..299 CDD:395101 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.