DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and UCP2

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:282 Identity:94/282 - (33%)
Similarity:141/282 - (50%) Gaps:26/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASVGAAMVTHPLDLIKVTLQTQQ----GHLSVAQLIPK----------LAREQGVLVFYNGLSAS 66
            |:..|.:.|.|||..||.||.|:    |.   .:.:||          :|||:|:...:.|:.|.
plant    22 AACFAELCTIPLDTAKVRLQLQRKIPTGD---GENLPKYRGSIGTLATIAREEGISGLWKGVIAG 83

  Fly    67 VLRQLTYSTARFGVYEAGKK-YVNTDSFGG-----KVALAGASGLVGGIVGTPADMVNVRMQNDV 125
            :.||..|...|.|:||..|. .|.:|..|.     |:..|..:|.:..||..|.|:|.||:|::.
plant    84 LHRQCIYGGLRIGLYEPVKTLLVGSDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG 148

  Fly   126 KLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQ 190
            |||....|.|..|.|....:.:.||...|::|.....||..::...::|.|||.|..::..|:|:
plant   149 KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIKETIMKIPFFR 213

  Fly   191 DNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKL-GPLGFFKGYVPA 254
            |:::||..|.|.||..|..:..|:||:|:|.|.  ...:....|....|.|. |.:.|:||::|.
plant   214 DSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMG--DSTYRNTVDCFIKTMKTEGIMAFYKGFLPN 276

  Fly   255 FVRLGPHTIITFVFLEQLRLKF 276
            |.|||....|.|:.|||::..|
plant   277 FTRLGTWNAIMFLTLEQVKKVF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/90 (32%)
PTZ00169 13..273 CDD:240302 93/277 (34%)
Mito_carr 89..184 CDD:278578 31/99 (31%)
Mito_carr 189..278 CDD:278578 33/89 (37%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 93/278 (33%)
Mito_carr 212..300 CDD:395101 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.