DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and AT5G19760

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:298 Identity:107/298 - (35%)
Similarity:151/298 - (50%) Gaps:40/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QERK---SMW------FFGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPKLAREQGVLVF 59
            :|:|   |:|      ..||.:.:.|..|..|:|:|||.:|..||  |.|.:...:.:.:||..|
plant     3 EEKKAPISVWTTVKPFVNGGASGMLATCVIQPIDMIKVRIQLGQG--SAASITTNMLKNEGVGAF 65

  Fly    60 YNGLSASVLRQLTYSTARFGVYE--AGKKYVNTDSFGGK------VALAG-ASGLVGGIVGTPAD 115
            |.||||.:|||.||:|||.|.::  ..|...:.|   ||      .||.| .:|.:|..||:|||
plant    66 YKGLSAGLLRQATYTTARLGSFKLLTAKAIESND---GKPLPLYQKALCGLTAGAIGACVGSPAD 127

  Fly   116 MVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTK 180
            :..:|||.|..||..|||||.|||..|.|:...||...|:.|......|.:.:.:|.:|.|||  
plant   128 LALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLASYDQ-- 190

  Fly   181 IYLLATPYFQDNL-----VTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPG-----EFNGLWDI 235
                :..|.:|||     .|...||.|:|..|...:.|.|.:||:....:|.     .:.|..|.
plant   191 ----SAEYMRDNLGFGEMSTVVGASAVSGFCAAACSLPFDFVKTQIQKMQPDAQGKYPYTGSLDC 251

  Fly   236 VKHTAKL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQL 272
            ...|.|. |||.|:.|:....||:.||.::|::||.|:
plant   252 AMKTLKEGGPLKFYSGFPVYCVRIAPHVMMTWIFLNQI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 33/89 (37%)
PTZ00169 13..273 CDD:240302 103/280 (37%)
Mito_carr 89..184 CDD:278578 39/101 (39%)
Mito_carr 189..278 CDD:278578 31/95 (33%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 31/75 (41%)
Mito_carr 101..199 CDD:395101 39/103 (38%)
Mito_carr 210..292 CDD:395101 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.