DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and AT4G03115

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:280 Identity:93/280 - (33%)
Similarity:140/280 - (50%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLASVGAAM---VTHPLDLIKVTLQT----QQGHL-SVAQLIPKLAREQGVLVFYNGLSASVLRQ 70
            |::.:..|:   ||||||::||.||.    |:|.| .:..:..:|.:.:|....|.||:.::.|.
plant    71 GISGISVALATGVTHPLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRS 135

  Fly    71 LTYSTARFGVYEAGKKYVNTD-SFGG-KVALAGASGLVGGIVGT----PADMVNVRMQ-NDVKLP 128
            :.|...|.|:||..|  |:.| :||. .|.:..|||...|...|    |.::|.||:| |...:|
plant   136 VLYGGLRLGLYEPTK--VSFDWAFGSTNVLVKIASGAFAGAFSTALTNPVEVVKVRLQMNPNAVP 198

  Fly   129 PQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNL 193
            ..:.|          .:..:||...|:.|...|..|...:|..|:|.||:.|..|:.....::..
plant   199 IAEVR----------EIVSKEGIGALWKGVGPAMVRAAALTASQLATYDEAKRILVKRTSLEEGF 253

  Fly   194 VTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF-----NGLWDIVKHTAKLGPLGFFKGYVP 253
            ..|..:|:|||.::|.:|.|:|::|||.|..:..|.     ||.....|...|.|||..:||...
plant   254 HLHLCSSVVAGLVSTLITAPMDMIKTRLMLQQGSESTKTYRNGFHCGYKVVRKEGPLALYKGGFA 318

  Fly   254 AFVRLGPHTIITFVFLEQLR 273
            .|.||||.|:|||:..|:||
plant   319 IFARLGPQTMITFILCEKLR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/86 (34%)
PTZ00169 13..273 CDD:240302 91/278 (33%)
Mito_carr 89..184 CDD:278578 29/101 (29%)
Mito_carr 189..278 CDD:278578 35/90 (39%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.