DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and PUMP1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:275 Identity:100/275 - (36%)
Similarity:143/275 - (52%) Gaps:19/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPK----------LAREQGVLVFYNGLSASVLRQ 70
            |.|| .:.|.|||..||.||.|:..|:....:||          :|||:|:...:.|:...:.||
plant    22 ACVG-EVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQ 85

  Fly    71 LTYSTARFGVYEAGKK-YVNTDSFG----GKVALAG-ASGLVGGIVGTPADMVNVRMQNDVKLPP 129
            ..:...|.|:||..|. ||..|..|    .|..||| .:|.:|.:|..|.|:|.||:|.:.||..
plant    86 CLFGGLRIGMYEPVKNLYVGKDFVGDVPLSKKILAGLTTGALGIMVANPTDLVKVRLQAEGKLAA 150

  Fly   130 QQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLV 194
            ...|.|:.|.:....:.||||.:.|::|.....||..::...::|.|||.|..:|..|.|.||:|
plant   151 GAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILKIPGFTDNVV 215

  Fly   195 THFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKL-GPLGFFKGYVPAFVRL 258
            ||..:.|.||..|..:..|:||:|:|.| ...|.:.|..|....|.|. ||:.|:||::|.|.||
plant   216 THILSGLGAGFFAVCIGSPVDVVKSRMM-GDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNFGRL 279

  Fly   259 GPHTIITFVFLEQLR 273
            |...:|.|:.|||.:
plant   280 GSWNVIMFLTLEQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/86 (34%)
PTZ00169 13..273 CDD:240302 100/273 (37%)
Mito_carr 89..184 CDD:278578 33/99 (33%)
Mito_carr 189..278 CDD:278578 36/86 (42%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 29/84 (35%)
Mito_carr 110..206 CDD:395101 32/95 (34%)
Mito_carr 210..299 CDD:395101 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.