DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and UCP5

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:301 Identity:109/301 - (36%)
Similarity:153/301 - (50%) Gaps:38/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQ--LIPKLA------------------------ 51
            ||:||:.|...|||||||||.:|. ||..:..|  |.|.||                        
plant     9 GGIASIVAGCSTHPLDLIKVRMQL-QGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLI 72

  Fly    52 REQGVLVFYNGLSASVLRQLTYSTARFGVYEAGK-----KYVNTDSFGGKVALAGASGLVGGIVG 111
            ||:|:...::|:||:||||..|||.|.|:|:..|     ....|.....|:.....:|.:|..||
plant    73 REEGMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWTDPETKTMPLMKKIGAGAIAGAIGAAVG 137

  Fly   112 TPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFY 176
            .|||:..||||.|.:||...||||.:..|.:.::.|.||...|:.|::....|.:|:|..|:|.|
plant   138 NPADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASY 202

  Fly   177 DQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK-----PGEFNGLWDIV 236
            |..|..:|.....:|.|.||.:||..||.:|:..:.|:||:|||.||.|     ...:.|..|..
plant   203 DSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKVVAGVAPPYKGAVDCA 267

  Fly   237 KHTAKL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKF 276
            ..|.|. |.:..:||::|...|..|.|::.||.|||::..|
plant   268 LKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 40/109 (37%)
PTZ00169 13..273 CDD:240302 108/296 (36%)
Mito_carr 89..184 CDD:278578 34/94 (36%)
Mito_carr 189..278 CDD:278578 35/94 (37%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 38/97 (39%)
Mito_carr <136..213 CDD:395101 31/76 (41%)
Mito_carr 216..311 CDD:395101 35/93 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.