DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and ucp3

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:280 Identity:94/280 - (33%)
Similarity:141/280 - (50%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFG-GLASVGAAMVTHPLDLIKVTLQTQ--QG---------HLSVAQLIPKLAREQGVLVFYNGL 63
            ||| |.|:..|.:||.|||..||.||.|  .|         :..|...|..:.|.:|....||||
Zfish    17 FFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTMVRTEGARSLYNGL 81

  Fly    64 SASVLRQLTYSTARFGVYEAGKKYVNTDSFGGKVA---LAG-ASGLVGGIVGTPADMVNVRMQND 124
            .|.:.||:::::.|.|:|::.|::....|....:.   ||| .:|.:......|.|:|.||.|..
Zfish    82 VAGLQRQMSFASVRIGLYDSMKQFYTRGSENASIVTRLLAGCTTGAMAVAFAQPTDVVKVRFQAQ 146

  Fly   125 VKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYF 189
            |:.....:| ||...|....:.|.||.:.|:.|......|..::...::..||..|..:|.....
Zfish   147 VRHTDGGKR-YNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYDIIKDLILKYDLM 210

  Fly   190 QDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF-NGLWDIVKHTAKLGPLGFFKGYVP 253
            .|||..||||:..||...|.:..|:||:|||.||:..|:: :.|...:....|.||..|:||::|
Zfish   211 TDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSAGQYGSALNCALMMLTKEGPAAFYKGFMP 275

  Fly   254 AFVRLGPHTIITFVFLEQLR 273
            :|:|||...|:.||..||::
Zfish   276 SFLRLGSWNIVMFVSYEQIK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 32/92 (35%)
PTZ00169 13..273 CDD:240302 92/276 (33%)
Mito_carr 89..184 CDD:278578 25/98 (26%)
Mito_carr 189..278 CDD:278578 36/86 (42%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 32/92 (35%)
PTZ00169 14..298 CDD:240302 94/280 (34%)
Mito_carr 114..207 CDD:278578 25/93 (27%)
Mito_carr 211..301 CDD:278578 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.