DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Slc25a27

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:298 Identity:83/298 - (27%)
Similarity:140/298 - (46%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MVTHPLDLIKVTLQTQQGHLSVAQL-------IP---------KLAREQGVLVFYNGLSASVLRQ 70
            :.|.||||.|..|| .||..::|:|       .|         .:.:|:|.|..:.|::.::.|.
Mouse    48 LTTFPLDLTKTRLQ-MQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRH 111

  Fly    71 LTYSTARFGVYEAGKKYVNTDS-----------FGGKVALAGASGLVGGIVGTPADMVNVRMQND 124
            :.||..|...||..::.|...|           .||.:|     |::|..:..|.|:|.|:||.:
Mouse   112 VVYSGGRMVTYEHLREVVFGKSEDKHYPLWKSVIGGMMA-----GVIGQFLANPTDLVKVQMQME 171

  Fly   125 VKL----PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLA 185
            .|.    .|.:.|..::||   .::..:.|.:.|::|......|..|:.:|.:..||..|.||:.
Mouse   172 GKRRLEGKPLRFRGVHHAF---AKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLVL 233

  Fly   186 TPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKL-------- 242
            ....:||:.||..:||.:|.:|:.|..|.||:|:|.|| :|.:..|...:.|.:|..        
Mouse   234 NTPLEDNISTHGLSSLCSGLVASILGTPADVIKSRIMN-QPRDKQGRGLLYKSSADCLIQAVQGE 297

  Fly   243 GPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFGTLN 280
            |.|..:||::|:::|:.....:.|:.|....|.|..|:
Mouse   298 GFLSLYKGFLPSWLRMVKMGEVLFLPLLLFSLYFSYLS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 24/85 (28%)
PTZ00169 13..273 CDD:240302 80/289 (28%)
Mito_carr 89..184 CDD:278578 27/109 (25%)
Mito_carr 189..278 CDD:278578 30/96 (31%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 24/83 (29%)
Mito_carr 138..232 CDD:365909 26/101 (26%)
Mito_carr 240..>314 CDD:365909 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.