DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and UCP1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:286 Identity:89/286 - (31%)
Similarity:141/286 - (49%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFGGLASVGAAMVTHPLDLIKVTLQTQQ--------GHLSVAQLIPKLAREQGVLVFYNGLSASV 67
            |..|:|:..|.::|.|||..||.||.|.        .:..|...|..:.:.:|.:..|:||.|.:
Human    18 FSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGL 82

  Fly    68 LRQLTYSTARFGVYE-------AGKKYVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDV 125
            .||::.::.|.|:|:       |||:  ...|.|.|:.....:|.|...:|.|.::|.||:|...
Human    83 QRQISSASLRIGLYDTVQEFLTAGKE--TAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQS 145

  Fly   126 KL---PPQQRRNYNNAFDGLVRVYR----QEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL 183
            .|   .|:....||        .||    .||...|:.|.|....|.:::...::..||..|...
Human   146 HLHGIKPRYTGTYN--------AYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAF 202

  Fly   184 LATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWD-IVKHTAKLGPLGF 247
            :......|::..|..::|:||..||.::.|:||:|||.:|:.||::..:.: .:|.....||..|
Human   203 VKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF 267

  Fly   248 FKGYVPAFVRLGPHTIITFVFLEQLR 273
            |||.||:|:|||...:|.||..|||:
Human   268 FKGLVPSFLRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 28/95 (29%)
PTZ00169 13..273 CDD:240302 87/282 (31%)
Mito_carr 89..184 CDD:278578 26/101 (26%)
Mito_carr 189..278 CDD:278578 35/86 (41%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 25/85 (29%)
Solcar 1 11..102 25/83 (30%)
Mito_carr 111..206 CDD:278578 26/102 (25%)
Solcar 2 111..201 26/97 (27%)
Solcar 3 210..295 35/84 (42%)
Mito_carr 215..300 CDD:278578 34/79 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.