DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:229 Identity:64/229 - (27%)
Similarity:112/229 - (48%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL-----------IPKLAREQGVLVFYNGLSA 65
            :|||||:.|...|.|:||.|..||. ||..:.|..           :.::.||:|:...|:|::.
Mouse    11 YGGLASITAECGTFPIDLTKTRLQI-QGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAP 74

  Fly    66 SVLRQLTYSTARFGVYEAGKKYV----NTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVK 126
            ::|||.:|.|.:.|.|::.|:..    ..::....|.....||::...:..|.|::.:|||    
Mouse    75 AMLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQ---- 135

  Fly   127 LPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQD 191
              .|.........|..:.:|:|||.:.|:.|.:....|..::...::..||.||.:|:.:....|
Mouse   136 --AQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD 198

  Fly   192 NLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK 225
            .:.|||.:|...|.:....:.|:||::||.||.:
Mouse   199 TVATHFLSSFTCGLVGALASNPVDVVRTRMMNQR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/94 (31%)
PTZ00169 13..273 CDD:240302 64/228 (28%)
Mito_carr 89..184 CDD:278578 21/94 (22%)
Mito_carr 189..278 CDD:278578 13/37 (35%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 29/85 (34%)
Mito_carr 105..191 CDD:365909 21/91 (23%)
Mito_carr 199..>259 CDD:365909 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.