DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and slc25a11

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001025683.1 Gene:slc25a11 / 595075 XenbaseID:XB-GENE-979673 Length:305 Species:Xenopus tropicalis


Alignment Length:280 Identity:109/280 - (38%)
Similarity:161/280 - (57%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQ-------TQQGHLSVAQLIPKLAREQGVLVFYNGLSASV 67
            :.|||||.:||.:...||||:|..:|       |::...|. ..:..:.|.:|:...|.||||.:
 Frog    16 FLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSF-HAVGSILRNEGLRGIYTGLSAGL 79

  Fly    68 LRQLTYSTARFGVYE-AGKKYVNTD----SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKL 127
            |||.||:|.|.|:|. ..:|:...|    :|..|.|:...:|..|..|||||::..:||..|.::
 Frog    80 LRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRM 144

  Fly   128 PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDN 192
            |..|||.|.|.|:.|||:.|:||...|:.|.....||.:::...|:|.|.|:|.:||.|.||.|:
 Frog   145 PVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSKQFLLDTGYFGDD 209

  Fly   193 LVTHFTASLVAGTIATTLTQPLDVLKTRSMN-----AKPGEFNGLWDIVKHTAKLGPLGFFKGYV 252
            ::.||.||:::|.:.|..:.|:|:.|||..|     .||...|||..:||.....|....:||:.
 Frog   210 ILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFT 274

  Fly   253 PAFVRLGPHTIITFVFLEQL 272
            |.:.||||||::||:||||:
 Frog   275 PYYARLGPHTVLTFIFLEQM 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 33/93 (35%)
PTZ00169 13..273 CDD:240302 108/277 (39%)
Mito_carr 89..184 CDD:278578 36/98 (37%)
Mito_carr 189..278 CDD:278578 37/89 (42%)
slc25a11NP_001025683.1 PTZ00169 13..296 CDD:240302 109/280 (39%)
Mito_carr 13..93 CDD:278578 30/77 (39%)
Mito_carr 107..202 CDD:278578 36/94 (38%)
Mito_carr 210..302 CDD:278578 35/85 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.