DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and slc25a10

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:280 Identity:161/280 - (57%)
Similarity:194/280 - (69%) Gaps:7/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QERKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQG-HLSVAQLIPKLAREQGVLVFYNGLSASV 67
            :.|.|.|:||||||.|||..|||||||||.|||||. .:.:..:...:.|..|.|..|||||||:
 Frog     3 ERRVSRWYFGGLASCGAACCTHPLDLIKVHLQTQQEVKMRMTGMAISVIRNDGFLALYNGLSASL 67

  Fly    68 LRQLTYSTARFGVYEAGKKYVNTDS-----FGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKL 127
            .||:|||..||.:||..:..:..|:     |..||.|....|..||.:|||||||||||||||||
 Frog    68 FRQITYSLTRFAIYETARDRLMQDNKAPLPFYQKVLLGAVGGFTGGFIGTPADMVNVRMQNDVKL 132

  Fly   128 PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDN 192
            |...||||.:|.||:.||.|:|||::||||||.|::||.|:|:||:|.|||.|..:|.|.:..||
 Frog   133 PAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQAKQLVLNTGFLSDN 197

  Fly   193 LVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVR 257
            :.|||.||.:||..||.|.|||||||||.|||| ||:.|:......|||||||.|:||.|||.:|
 Frog   198 IFTHFLASSIAGGCATFLCQPLDVLKTRLMNAK-GEYRGVVHCTLETAKLGPLAFYKGLVPAGIR 261

  Fly   258 LGPHTIITFVFLEQLRLKFG 277
            |.|||::|||||||||..||
 Frog   262 LIPHTVLTFVFLEQLRKYFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 43/82 (52%)
PTZ00169 13..273 CDD:240302 153/265 (58%)
Mito_carr 89..184 CDD:278578 57/99 (58%)
Mito_carr 189..278 CDD:278578 57/89 (64%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 41/76 (54%)
Mito_carr 96..190 CDD:365909 56/93 (60%)
Mito_carr 197..281 CDD:365909 54/84 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5780
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I2606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 1 1.000 - - mtm9566
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 1 1.000 - - X1953
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.