DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Ucp2

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_062227.2 Gene:Ucp2 / 54315 RGDID:3932 Length:309 Species:Rattus norvegicus


Alignment Length:289 Identity:92/289 - (31%)
Similarity:143/289 - (49%) Gaps:36/289 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FFG-GLASVGAAMVTHPLDLIKVTLQTQ---QG---------HLSVAQLIPKLAREQGVLVFYNG 62
            |.| |.|:..|.::|.|||..||.||.|   ||         :..|...|..:.|.:|....|||
  Rat    17 FLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYRGVLGTILTMVRTEGPRSLYNG 81

  Fly    63 LSASVLRQLTYSTARFGVYEAGKKYVNTDS----FGGKVALAGASGLVGGIVGTPADMVNVRMQN 123
            |.|.:.||:::::.|.|:|::.|::....|    .|.::.....:|.:...|..|.|:|.||.| 
  Rat    82 LVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQ- 145

  Fly   124 DVKLPPQQR----RNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLL 184
                 .|.|    |.|.:..:....:.|:||.:.|:.|.:...||..::...::..||..|..||
  Rat   146 -----AQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCTELVTYDLIKDTLL 205

  Fly   185 ATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTA-----KLGP 244
            ......|:|..|||::..||...|.:..|:||:|||.||:..|:::.    ..|.|     |.||
  Rat   206 KANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHS----AGHCALTMLRKEGP 266

  Fly   245 LGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            ..|:||::|:|:|||...::.||..|||:
  Rat   267 RAFYKGFMPSFLRLGSWNVVMFVTYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 31/93 (33%)
PTZ00169 13..273 CDD:240302 90/285 (32%)
Mito_carr 89..184 CDD:278578 24/102 (24%)
Mito_carr 189..278 CDD:278578 35/90 (39%)
Ucp2NP_062227.2 Mito_carr 10..111 CDD:395101 31/93 (33%)
Solcar 1 11..106 31/88 (35%)
Mito_carr 112..206 CDD:395101 24/99 (24%)
Solcar 2 114..203 23/94 (24%)
Solcar 3 212..297 35/88 (40%)
Mito_carr 217..299 CDD:395101 33/83 (40%)
Purine nucleotide binding. /evidence=ECO:0000250 276..298 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.