DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and aralar1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:125/292 - (42%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL--------IPKLAREQGVLVFYNGLSASVLR 69
            |..|....|.|.:|:||:|..:|.|:....:.::        ..|:.|.:|.:..|.||    |.
  Fly   361 GSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGL----LP 421

  Fly    70 QLTYSTARFGV--YEAGKKYVN-------TDSFG-----GKVALAGASGLVGGIVGTPADMVNVR 120
            ||      .||  .:|.|..||       ||..|     .:|...|.:|....:...|.::|.:|
  Fly   422 QL------MGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIR 480

  Fly   121 MQNDVKLPPQQRRNYNNAFDGLVR---VYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY 182
            :|...::          |....:|   |.|:.|...|:.||.|...|.:..:......|..||. 
  Fly   481 LQVAGEI----------ASGSKIRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKA- 534

  Fly   183 LLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTR-SMNAKPGE--FNGLWDIVKH-TAKLG 243
            ::|.....::.:|...|..:||..|.:|..|.||:||| .:.|:.|:  :.|:||..|. .|:.|
  Fly   535 MMADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEG 599

  Fly   244 PLGFFKGYVPAFVRLGPH---TIITFVFLEQL 272
            |..|:||......|..|.   |::|:..|::|
  Fly   600 PRAFWKGTAARVFRSSPQFGVTLVTYELLQRL 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 26/95 (27%)
PTZ00169 13..273 CDD:240302 79/292 (27%)
Mito_carr 89..184 CDD:278578 24/109 (22%)
Mito_carr 189..278 CDD:278578 30/91 (33%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 27/96 (28%)
PTZ00169 358..631 CDD:240302 78/290 (27%)
Mito_carr 449..539 CDD:278578 22/100 (22%)
Mito_carr 544..633 CDD:278578 30/88 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.