DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and DPCoAC

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:114/278 - (41%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQG-----HLSVAQLIPKLAREQGVLVFYNGLSASVLRQLT 72
            |..|...|..|..|||..|:..|.:..     ..|:..|....|.| |||..:.|.||::.|.:.
  Fly    79 GAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANE-GVLALWRGNSATMARIVP 142

  Fly    73 YSTARFGVYEAGKKYVNTDSFG----GKVALAGA-SGLVGGIVGTPADMVNVRMQNDVKLPPQQR 132
            |:..:|..:|..::.::.|..|    |:..|||: :|:....:..|.|:...||     ....:.
  Fly   143 YAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARM-----AVTDRY 202

  Fly   133 RNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQ------D 191
            ..|........:::.:||.:.||.|.. ||..|::...|...|..:|    |...|::      .
  Fly   203 TGYRTLRQVFTKIWVEEGPRTLFRGYW-ATVLGVIPYAGTSFFTYET----LKREYYEVVGNNKP 262

  Fly   192 NLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNG------LWDIVKHTAKLG-PLGFFK 249
            |.:........||....|.:.|||:::.|....:.....|      |..:||...:.| ..||:|
  Fly   263 NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYK 327

  Fly   250 GYVPAFVRLGPHTI-ITF 266
            |....::: ||..: |:|
  Fly   328 GLSMNWIK-GPIAVGISF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/83 (28%)
PTZ00169 13..273 CDD:240302 69/278 (25%)
Mito_carr 89..184 CDD:278578 23/99 (23%)
Mito_carr 189..278 CDD:278578 21/92 (23%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/80 (29%)
Mito_carr 169..251 CDD:278578 22/91 (24%)
Mito_carr 279..356 CDD:278578 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.