DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and GC1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:110/284 - (38%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQ-------GHLSVAQLIPKLAREQGVLVFYNGLSASVLRQ 70
            ||:|.:.......||||:|..||.||       .:.|:.....|..:.:|....|.|...::|..
  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLI 92

  Fly    71 LTYSTARFGVYEAGKKYVNTDSFGGKVALAG---ASGLVGG---IVGTPADMVNVRMQN------ 123
            ......:....:..:..:.|..  ||:.|..   |.||.|.   ||.||.:::.::||:      
  Fly    93 TPEKAIKLTANDYFRHKLTTKD--GKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAA 155

  Fly   124 DVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY--LLAT 186
            ..||..:..... :|.....::.:.:|...|:.|..|...|.:..:|          ||  |.||
  Fly   156 AAKLAGKTVEKV-SATQLASQLIKDKGIFGLYKGIGATGLRDVTFSI----------IYFPLFAT 209

  Fly   187 -----PYFQDN-----LVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPG----EFNGLWDIVK 237
                 |...|.     ....|.|.|.||:.|.....|.||:|||....|..    ||.|:.|.:.
  Fly   210 LNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFKGISDCIT 274

  Fly   238 HTAK-LGPLGFFKGYVPAFVRLGP 260
            .|.| .||..||||.:...:.:.|
  Fly   275 KTLKHEGPTAFFKGGLCRMIVIAP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 19/85 (22%)
PTZ00169 13..273 CDD:240302 74/284 (26%)
Mito_carr 89..184 CDD:278578 25/108 (23%)
Mito_carr 189..278 CDD:278578 27/82 (33%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 15/76 (20%)
Mito_carr 115..213 CDD:278578 27/108 (25%)
Mito_carr 226..307 CDD:278578 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.