DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Tpc1

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:317 Identity:68/317 - (21%)
Similarity:126/317 - (39%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HQERKSM--WFFGGLASVGAAMVTHPLDLIKVTLQTQ----------QG-------HLSVAQLIP 48
            |..|:.:  ...|||::........|||::|:..|.|          :|       :.|:.|.:.
  Fly    23 HSTREQLHQMLAGGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVK 87

  Fly    49 KLAREQGVLVFYNGLSASVLRQLTYSTARFGVYE------AGKKYVNTDSFGGKVALAGASGLVG 107
            .:.||:|:|.|:.|.:.:.:..:.|...:|..||      ....|:.............|:|...
  Fly    88 TIYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAA 152

  Fly   108 GIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQ 172
            .|:.||.|::..|:     :.....:.|.||...:..:.||||.:.::.|.::|     |:.|..
  Fly   153 VIISTPLDVIRTRL-----IAQDTSKGYRNATRAVSAIVRQEGPRGMYRGLSSA-----LLQITP 207

  Fly   173 I---------AFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGE 228
            :         .|.|....:|..:...|....|.......:|.::.|:..|.|::|.| :..:..|
  Fly   208 LMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKR-LQIQGFE 271

  Fly   229 FN-----------GLWDIVKHTAKL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            .|           |:||.::.|.:. |..|.:||..|..::....|.:.|...::|:
  Fly   272 SNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/104 (22%)
PTZ00169 13..273 CDD:240302 65/303 (21%)
Mito_carr 89..184 CDD:278578 20/103 (19%)
Mito_carr 189..278 CDD:278578 22/97 (23%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/93 (24%)
PTZ00169 33..329 CDD:240302 66/307 (21%)
Mito_carr 153..222 CDD:278578 17/78 (22%)
Mito_carr 233..328 CDD:278578 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.