DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and CG6893

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:272 Identity:104/272 - (38%)
Similarity:159/272 - (58%) Gaps:10/272 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYS 74
            |:.||:|...|...|.|.|||:..:...:....:|..:.:..|..|.:..|:||||.:||||||:
  Fly    18 WWSGGVAGAIAQCFTAPFDLIEARMVVIKKDRGMASNLQQAIRTHGFISLYDGLSAQLLRQLTYT 82

  Fly    75 TARFGVYEAGKKYVNTDSFG--GKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNN 137
            :.||.:||.||:::: |..|  .||.:|..:|.|.|:||||.:::|.|||.:..||.:.|.||.|
  Fly    83 SMRFHLYEMGKEHLD-DPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQVNRALPKETRWNYRN 146

  Fly   138 AFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTK-IYLLATPYFQDNLVTHFTASL 201
            .||||.||.|:|||.:|:||...:..|..|:||.|.|.|||.| ||........||.:.|..:|:
  Fly   147 VFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMKHDNTLLHLISSV 211

  Fly   202 VAGTIATTLTQPLDVLK-TRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVRLGPHTIIT 265
            .|..:...:.:|::.|: .|.::::     .|.:.:.:..:.|..|.|:|.||..:|:.|:|:||
  Fly   212 TAAFVCGPIIKPIENLRYLRMVDSR-----RLINSISYMMRFGSRGPFRGMVPYVLRMVPNTVIT 271

  Fly   266 FVFLEQLRLKFG 277
            |:..||||:.||
  Fly   272 FLSFEQLRVNFG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 30/81 (37%)
PTZ00169 13..273 CDD:240302 99/263 (38%)
Mito_carr 89..184 CDD:278578 47/97 (48%)
Mito_carr 189..278 CDD:278578 27/90 (30%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 29/75 (39%)
Mito_carr 98..192 CDD:395101 45/93 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.