DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and SLC25A35

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001307799.1 Gene:SLC25A35 / 399512 HGNCID:31921 Length:300 Species:Homo sapiens


Alignment Length:299 Identity:81/299 - (27%)
Similarity:138/299 - (46%) Gaps:34/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WFFGGLASVGAAMVTHPLDLIKVTLQ---------TQQGHL-SVAQLIPKLAREQGVLVFYNGLS 64
            :...|||:.||.:.|:||:::|..:|         |.|.|. :|......:.:..|:.....||:
Human     3 FLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLAALQKGLA 67

  Fly    65 ASVLRQLTYSTARFGVY---EAGKKYVNT---DSFGGKVALAGA-SGLVGGIVGTPADMVNVRMQ 122
            .::|.|...:..|.|.|   ||| .|::|   .....:.|.||| :|::|..:|:|..||...:|
Human    68 PALLYQFLMNGIRLGTYGLAEAG-GYLHTAEGTHSPARSAAAGAMAGVMGAYLGSPIYMVKTHLQ 131

  Fly   123 ----NDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYL 183
                :::.:..|.:  :...|..|..:.::.|...|:.||.....|.|:.:..|:..:..||..|
Human   132 AQAASEIAVGHQYK--HQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLL 194

  Fly   184 LATPYF-QDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGE-------FNGLWDIVKHTA 240
            .....| ..:......|::::|........|.||..||..| :|.:       :.|:.|.:..||
Human   195 SQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYN-QPTDAQGKGLMYRGILDALLQTA 258

  Fly   241 KL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFGT 278
            :. |..|.:||...::.|||||||::..|.:|||..:.|
Human   259 RTEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSLYYT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 27/97 (28%)
PTZ00169 13..273 CDD:240302 78/289 (27%)
Mito_carr 89..184 CDD:278578 24/102 (24%)
Mito_carr 189..278 CDD:278578 29/97 (30%)
SLC25A35NP_001307799.1 Solcar 1 1..90 23/86 (27%)
Mito_carr 2..84 CDD:278578 21/80 (26%)
Solcar 2 100..193 23/94 (24%)
Mito_carr <119..194 CDD:278578 17/76 (22%)
Solcar 3 203..294 28/91 (31%)
Mito_carr 209..298 CDD:278578 29/90 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.