DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and slc25a27

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:319 Identity:94/319 - (29%)
Similarity:149/319 - (46%) Gaps:50/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPHQERKSMW------FFGGLASVGAAMVTHPLDLIKVTLQTQ-----------------QGHLS 42
            |.|.:..|.|      .....|:..|.:||.||||.|..||.|                 :|.||
Zfish     1 MSHLQENSRWPRVSKFTLSACAAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLS 65

  Fly    43 VAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEAGKKYVNTDSFGG-----KVALAG- 101
            .|   ..:.||:|.|..:.|::.::.|.:.||..|...||..::.|...|..|     |..:|. 
Zfish    66 TA---AGIVREEGPLKLWQGVTPAIYRHIVYSGGRMLAYEQMRESVLGKSEDGIFPVWKAVIASM 127

  Fly   102 ASGLVGGIVGTPADMVNVRMQNDVK-----LPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAA 161
            .||.:|..:.:|.|:|.|:||.:.:     .||:.|..| :||   .::..|.|.:.|::|....
Zfish   128 ISGALGQFIASPTDLVKVQMQMEGRRRLEGKPPRVRGVY-HAF---TKIVAQGGIRGLWAGWVPN 188

  Fly   162 TARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKP 226
            ..|..|:.:|.:..||..|.:||......||.:.|..:|:.:|.:|.|:..|.||:|||.|| :|
Zfish   189 VQRAALVNLGDLMTYDTVKHFLLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVKTRVMN-QP 252

  Fly   227 GEFNG---LWD-----IVKHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKFG 277
            .:.||   |:.     :|:...:.|....:||::|.:.|:.|.::..::..||||...|
Zfish   253 RDSNGRGLLYRNSTDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRRAMG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/104 (28%)
PTZ00169 13..273 CDD:240302 87/295 (29%)
Mito_carr 89..184 CDD:278578 29/105 (28%)
Mito_carr 189..278 CDD:278578 31/97 (32%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 28/101 (28%)
PTZ00169 16..310 CDD:240302 89/301 (30%)
Mito_carr 118..213 CDD:278578 29/98 (30%)
Mito_carr 217..311 CDD:278578 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.