DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and slc25a14

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:285 Identity:85/285 - (29%)
Similarity:137/285 - (48%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FGGLASVGAAMVTHPLDLIKVTLQTQ-QGHL------SVAQLIPKLAREQGVLVFYNGLSASVLR 69
            :||:||:.|...|.|:||.|..||.| |.|.      .:...:.::.||:||...|:|:|.::||
Zfish    60 YGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLR 124

  Fly    70 QLTYSTARFGVYEAGKK----YVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQ-NDVKLPP 129
            |.:|.|.:.|.|...||    :...::....|.....||::...:..|.|::.:||| ....|..
Zfish   125 QASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQG 189

  Fly   130 QQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLV 194
            ....|:.|       :|:.||.:.|:.|......|..::...::..||.||.:|:.:....|.::
Zfish   190 SMMSNFMN-------IYQTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVL 247

  Fly   195 THFTASLVAGTIATTLTQPLDVLKTRSMNAK--------PGEFNGLWDIVKHTAKLGPLGFF--- 248
            |||.:|...|......:.|:||::||.||.:        .|..:||....::.      |||   
Zfish   248 THFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNE------GFFALY 306

  Fly   249 KGYVPAFVRLGPHTIITFVFLEQLR 273
            ||:.|.::||||..||.|:..|||:
Zfish   307 KGFWPNWLRLGPWNIIFFMTFEQLK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 31/90 (34%)
PTZ00169 13..273 CDD:240302 84/282 (30%)
Mito_carr 89..184 CDD:278578 21/95 (22%)
Mito_carr 189..278 CDD:278578 32/96 (33%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.