DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and PMP34

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:303 Identity:75/303 - (24%)
Similarity:127/303 - (41%) Gaps:51/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLASVGAAMVT-HPLDLIKVTLQTQQ-GHL-SVAQLIPKLAREQGVLVFYNGLSASVLRQLTYST 75
            |.|....||.| :|||.::..||.:: |.: |..|:|.::...:|....|.|| ..||:.|..|.
  Fly    22 GAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGL-GPVLQSLCISN 85

  Fly    76 -ARFGVYEAGKKYVNTDSFGGK---------VALAGASGLVGGIVGTPADMVN--VRMQNDVKLP 128
             ..|..:.|.|...:    ||.         :.|...:|::..:..||..:||  :||:|.....
  Fly    86 FVYFYTFHALKAVAS----GGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTS 146

  Fly   129 PQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIG----QIAFYDQTKIYLLATPYF 189
            .:..::|.|..:||..|..:||...|:||...:     ||.:.    |...|:..|..::.....
  Fly   147 DEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPS-----LMLVSNPALQFMMYEMLKRNIMRFTGG 206

  Fly   190 QDNLVTHFTASLVAGTIATTLTQPLDVLKT------RSMNAKPGEFNGLWDIVKHTAKL------ 242
            :...::.|....:|...||.||.||.:::|      :..::||....|.....:.|.:|      
  Fly   207 EMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQ 271

  Fly   243 --GPLGFFKGYVPAFVRLGPHTIIT----FVFLEQLRLKFGTL 279
              |..|.|:|.....::    |::|    |:..|::....|.|
  Fly   272 HQGIRGLFRGLEAKILQ----TVLTAALMFMAYEKIAGTVGML 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 25/81 (31%)
PTZ00169 13..273 CDD:240302 73/295 (25%)
Mito_carr 89..184 CDD:278578 26/109 (24%)
Mito_carr 189..278 CDD:278578 22/106 (21%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 24/74 (32%)
Mito_carr 105..202 CDD:278578 24/101 (24%)
Mito_carr 214..303 CDD:278578 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.