DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Tpc2

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:300 Identity:70/300 - (23%)
Similarity:118/300 - (39%) Gaps:51/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQ---------QGHLSVAQLIPKLAREQGVLVFYNGLSASVL 68
            ||:|......:|.|||::|:..|.|         ..:..|......:..|:|:...:.|.::..:
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGMRGMFRGHNSGQV 80

  Fly    69 RQLTYSTARFGVYEAGKK------YVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKL 127
            ..::|:..:|..||..:.      |.....|.......|.:|.:|.:...|.|:|..:|   |..
  Fly    81 LSISYALVQFWSYEQLRSMAHQFDYWRERPFLMFFICGGIAGCLGAVAAQPFDVVRTQM---VAA 142

  Fly   128 PPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQI--------AFYDQ-TKIYL 183
            .|..||:..|.|.||.:||:.||:..|        :||:..|:.|:        .||.. ....|
  Fly   143 DPSSRRSQMNTFTGLRKVYKMEGWMGL--------SRGLPFTLVQVFPLVGANFLFYKYLNAAVL 199

  Fly   184 LATPYFQDNLVTH----FTASLVAGTIATTLTQPLDVLKTR-----------SMNAKPGEFNGLW 233
            :|.|..|...: |    |....::|.:|..:..|.|:||.|           :....|.....|.
  Fly   200 MAKPPDQRQEI-HGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECPTILG 263

  Fly   234 DIVKHTAKLGPLGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            .|.....:.|..||:||.:|..::.|..:.:.|...:..:
  Fly   264 CITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 19/93 (20%)
PTZ00169 13..273 CDD:240302 70/298 (23%)
Mito_carr 89..184 CDD:278578 27/103 (26%)
Mito_carr 189..278 CDD:278578 21/99 (21%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 67/292 (23%)
Mito_carr 23..99 CDD:278578 15/75 (20%)
Mito_carr 108..194 CDD:278578 27/96 (28%)
Mito_carr 216..307 CDD:278578 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.