DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Shawn

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:316 Identity:74/316 - (23%)
Similarity:119/316 - (37%) Gaps:92/316 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ASVGAAMVTHPLDLIKVTLQTQQGHL--------------------------SVAQLIP------ 48
            |.|.|..:| |||:||..||.||..|                          :.|:..|      
  Fly    50 AMVTACFMT-PLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTI 113

  Fly    49 ----KLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEAGK--------KYV-NTDSFGGKV--- 97
                |::|.:|:...::|||.:::..|..:...|..||..|        ||. ..|:....:   
  Fly   114 DAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHP 178

  Fly    98 ------ALAGASGLVGGIV-GTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLF 155
                  .|||.||.:..:. .:|.:::..:||:       ||..:...|..:.:|.:.:|...|:
  Fly   179 IPFLVPLLAGVSGRILAVTCVSPVELIRTKMQS-------QRMTHAEMFGTIRQVVQSQGVLGLW 236

  Fly   156 SGATAATAR-----GILMTIGQIAFYDQTK-IYLLATPYFQDNLVTHFTASLVAGTIATTLTQPL 214
            .|......|     ||..|.     |:..| .:.:..|.|..:    |.|..::|::|.|:|.|.
  Fly   237 RGLPPTILRDVPFSGIYWTC-----YEYLKSSFGVVEPTFSFS----FAAGAISGSVAATITTPF 292

  Fly   215 DVLKTRS---------MNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPA-FVRLGP 260
            ||:||..         .:..|.:......:....|.:    :..|.||| |..|||
  Fly   293 DVVKTHEQIEFGEKFIFSDNPPKQVATKSVAMRLASI----YRMGGVPAIFSGLGP 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/120 (24%)
PTZ00169 13..273 CDD:240302 74/316 (23%)
Mito_carr 89..184 CDD:278578 22/110 (20%)
Mito_carr 189..278 CDD:278578 22/82 (27%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 27/109 (25%)
Mito_carr 178..265 CDD:278578 21/98 (21%)
Mito_carr 268..371 CDD:278578 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.