DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and sea

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:115/297 - (38%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGLASVGAAMVTHPLDLIKVTLQTQQ-----GHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLT 72
            ||:.......:|:|.:.:|..||..:     .:..:...:.|...|:|.|..|.|||..|...:.
  Fly    40 GGITGGIEICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIP 104

  Fly    73 YSTARFGVYEAGKKYVNTDSFG-----GKVALAGASGLVGGIVG-TPADMVNVRMQNDVKLPPQQ 131
            .|.||||.:|..|... .||.|     ||:.....:|:...||. ||.:.:.|:..||       
  Fly   105 KSAARFGAFEFLKSNA-VDSRGQLSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFIND------- 161

  Fly   132 RRNYNNAFDGLV----RVYRQEGFKRLFSGATAATARGILMTIGQ---IAFY------------D 177
            :|:.|..|.|..    ::.:.||...::.|.|..     ::..|.   |.|:            |
  Fly   162 QRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPT-----ILKQGSNQAIRFFVLESLKDLYKGDD 221

  Fly   178 QTK-IYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAK 241
            .|| :..|....|          ..:||..:.....||||:|||....:..::       |:||.
  Fly   222 HTKPVPKLVVGVF----------GAIAGAASVFGNTPLDVVKTRMQGLEASKY-------KNTAH 269

  Fly   242 L--------GPLGFFKGYVPAFVRLGPHTIITFVFLE 270
            .        ||..|:||.||...|:.....|||:..:
  Fly   270 CAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 23/83 (28%)
PTZ00169 13..273 CDD:240302 75/297 (25%)
Mito_carr 89..184 CDD:278578 27/120 (23%)
Mito_carr 189..278 CDD:278578 24/90 (27%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 73/291 (25%)
Mito_carr 34..117 CDD:278578 22/76 (29%)
Mito_carr 125..220 CDD:278578 22/106 (21%)
Mito_carr 235..314 CDD:278578 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.