DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and CG18327

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:143/297 - (48%) Gaps:39/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SMWFFGGLASVGAAMVTHPLDLIKVTLQTQ----------QGHLSVAQLIPKLAREQGVLVFYNG 62
            |.:..||:|::||.:.|:|:::||..:|.|          |.:.||.|....:|:..|:|....|
  Fly     4 SDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKG 68

  Fly    63 LSASVLRQLTYSTARFGVY--EAGKKYVNTDSFGGKVALAGAS--GLVGGIVG----TPADMVNV 119
            |:.::..|...::.|..:|  ...|.:|:.:.  |:::.|...  |.:||:||    :|..::..
  Fly    69 LAPALCFQFVINSFRLSIYTHAVEKGWVHNNK--GEISFAKGMFWGALGGVVGSYCASPFFLIKT 131

  Fly   120 RMQNDV--KLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY 182
            ::|...  ::....:..:.:..|.:.::||:.|...|:.|:.|..:|..:.:..|||.:.|.|..
  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSL 196

  Fly   183 LLATPYFQDNLVTH-----FTASLVAGTIATTLTQPLDVLKTRSMN------AKPGEFNGLWDIV 236
            |.     ::.:|||     |.:.|.||:..:....||||:.||..|      .:...:.|..|.|
  Fly   197 LK-----ENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCV 256

  Fly   237 KHTAKL-GPLGFFKGYVPAFVRLGPHTIITFVFLEQL 272
            ....:. |..|.:||:.|.::|..|::.:..:|.::|
  Fly   257 LTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 25/93 (27%)
PTZ00169 13..273 CDD:240302 74/292 (25%)
Mito_carr 89..184 CDD:278578 22/102 (22%)
Mito_carr 189..278 CDD:278578 26/96 (27%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 23/82 (28%)
PTZ00169 5..293 CDD:240302 73/294 (25%)
Mito_carr 101..201 CDD:278578 23/104 (22%)
Mito_carr 204..296 CDD:278578 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.