DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Slc25a30

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:141/289 - (48%) Gaps:39/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FGGLASVGAAMVTHPLDLIKVTLQTQQGHLSVAQL-----------IPKLAREQGVLVFYNGLSA 65
            :|||||:.|...|.|:||.|..||. ||..:.|:.           :.::.||:|:...|:|::.
  Rat    11 YGGLASITAECGTFPIDLTKTRLQI-QGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIAP 74

  Fly    66 SVLRQLTYSTARFGVYEAGKKYV----NTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVK 126
            ::|||.:|.|.:.|.|::.|:..    ..::....|.....||::...:..|.|::.:|||..  
  Rat    75 AMLRQASYGTIKIGTYQSLKRLAVERPEDETLLINVVCGILSGVISSAIANPTDVLKIRMQAQ-- 137

  Fly   127 LPPQQRRNYNNAFDG-----LVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLAT 186
                     |:|..|     .:.:|:|||.:.|:.|.:....|..::...::..||.||.:|:.:
  Rat   138 ---------NSAVQGGMIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   187 PYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKP------GEFNGLWDIVKHTAK-LGP 244
            ....|.:.|||.:|...|.:....:.|:||::||.||.:.      ..:.|..|.:..|.| .|.
  Rat   194 GLMGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQTWKNEGF 258

  Fly   245 LGFFKGYVPAFVRLGPHTIITFVFLEQLR 273
            ...:||:.|.::||||..||.|:..|||:
  Rat   259 FALYKGFWPNWLRLGPWNIIFFLTYEQLK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 29/94 (31%)
PTZ00169 13..273 CDD:240302 82/286 (29%)
Mito_carr 89..184 CDD:278578 22/99 (22%)
Mito_carr 189..278 CDD:278578 31/92 (34%)
Slc25a30NP_001013205.1 Solcar 1 7..96 29/85 (34%)
PTZ00169 9..289 CDD:240302 83/289 (29%)
Solcar 2 104..189 22/95 (23%)
Solcar 3 198..289 31/90 (34%)
Mito_carr 199..289 CDD:395101 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.