DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic1 and Dic3

DIOPT Version :9

Sequence 1:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:276 Identity:142/276 - (51%)
Similarity:186/276 - (67%) Gaps:2/276 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RKSMWFFGGLASVGAAMVTHPLDLIKVTLQTQQ--GHLSVAQLIPKLAREQGVLVFYNGLSASVL 68
            |...|:|||:.:..|...|||:|||||.||||.  ...:|.:::..:....|:|.||||:|||..
  Fly     8 RLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWF 72

  Fly    69 RQLTYSTARFGVYEAGKKYVNTDSFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRR 133
            |||||:|.||.:|||||.||:|.....|:|||..:|:||||||.|.|:|.||:|||||||.::||
  Fly    73 RQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRR 137

  Fly   134 NYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFT 198
            ||.:.||||.|:|::||...||.|...|.:|.:|:|||..|.|||.|..|.......:.:..||.
  Fly   138 NYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLHFA 202

  Fly   199 ASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFKGYVPAFVRLGPHTI 263
            .|.:||.||..:||||||:||..|||:||||:|:......|||.|||.|:||::||.:|:.|:||
  Fly   203 TSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIRVSPNTI 267

  Fly   264 ITFVFLEQLRLKFGTL 279
            ||||..||.|::||.|
  Fly   268 ITFVLYEQARMRFGYL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 43/83 (52%)
PTZ00169 13..273 CDD:240302 135/261 (52%)
Mito_carr 89..184 CDD:278578 50/94 (53%)
Mito_carr 189..278 CDD:278578 46/88 (52%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 133/259 (51%)
Mito_carr 15..91 CDD:278578 38/75 (51%)
Mito_carr 93..187 CDD:278578 50/93 (54%)
Mito_carr 200..281 CDD:278578 45/80 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468939
Domainoid 1 1.000 84 1.000 Domainoid score I1910
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I828
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 1 1.000 - - otm46877
orthoMCL 1 0.900 - - OOG6_104245
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1953
1211.750

Return to query results.
Submit another query.